| Edit |   |
|---|
| Antigenic Specificity | IFI44L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFI44L Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFI44L. This antibody reacts with human. The IFI44L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IFI44L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLL |
|---|
| Other Names | C1orf29, chromosome 1 open reading frame 29, GS3686, interferon-induced protein 44-like |
|---|
| Gene, Accession # | IFI44L, Gene ID: 10964, Accession: Q53G44, SwissProt: Q53G44 |
|---|
| Catalog # | NBP2-38892 |
|---|
| Price | |
|---|
| Order / More Info | IFI44L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|