| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IFIT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, monkey |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reported by a verified customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFIT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFIT1. This antibody reacts with human, monkey. The IFIT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IFIT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH |
|---|
| Other Names | G10P1C56, GARG-16, IFI56IFI-56, IFI-56K, IFIT-1, IFNAI1ISG56, Interferon, alpha-inducible protein (MW 56kD), Interferon-induced 56 kDa protein, interferon-induced protein 56, interferon-induced protein with tetratricopeptide repeats 1, p56, RNM561 |
|---|
| Gene, Accession # | IFIT1, Gene ID: 3434, Accession: P09914, SwissProt: P09914 |
|---|
| Catalog # | NBP2-33751 |
|---|
| Price | |
|---|
| Order / More Info | IFIT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30282041 |
|---|
| 产品资料 |
|
|