| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Acrosin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 27430551). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Acrosin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Acrosin. This antibody reacts with human, rat. The Acrosin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Acrosin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQ |
|---|
| Other Names | acrosin, ACRS, preproacrosin, proacrosin |
|---|
| Gene, Accession # | ACR, Gene ID: 49, Accession: P10323, SwissProt: P10323 |
|---|
| Catalog # | NBP2-14260 |
|---|
| Price | |
|---|
| Order / More Info | Acrosin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27430551, 28398669 |
|---|
| 产品资料 |
|
|