| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACSBG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACSBG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACSBG1. This antibody reacts with human. The ACSBG1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ACSBG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILER |
|---|
| Other Names | acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3, BG1, BGMBG, bubblegum, FLJ30320, hBG1, hsBG, hsBGM, KIAA0631GR-LACS, lipidosin, long-chain-fatty-acid--CoA ligase ACSBG1, LPD, MGC14352, very long-chain acyl-CoA synthetase |
|---|
| Gene, Accession # | ACSBG1, Gene ID: 23205 |
|---|
| Catalog # | NBP2-58214 |
|---|
| Price | |
|---|
| Order / More Info | ACSBG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|