| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fucosyltransferase 7/FUT7 |
|---|
| Clone | 1C12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fucosyltransferase 7/FUT7 Antibody (1C12) from Novus Biologicals is a mouse monoclonal antibody to Fucosyltransferase 7/FUT7. This antibody reacts with human. The Fucosyltransferase 7/FUT7 Antibody (1C12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FUT7 (NP_004470 262 a.a. - 342 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
|---|
| Other Names | alpha-(1,3)-fucosyltransferase, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.65, Fucosyltransferase 7, fucosyltransferase 7 (alpha (1,3) fucosyltransferase), Fucosyltransferase VII, fuc-TVII, FucT-VII, Galactoside 3-L-fucosyltransferase, Selectin ligand synthase, selectin-ligand synthase |
|---|
| Gene, Accession # | FUT7, Gene ID: 2529, Accession: NP_004470, SwissProt: NP_004470 |
|---|
| Catalog # | H00002529-M03 |
|---|
| Price | |
|---|
| Order / More Info | Fucosyltransferase 7/FUT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|