| Edit |   |
|---|
| Antigenic Specificity | CXorf40B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 74%, rat 79%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CXorf40B polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE |
|---|
| Other Names | chromosome X open reading frame 40B |
|---|
| Gene, Accession # | Gene ID: 541578, UniProt: Q96DE9, ENSG00000197021 |
|---|
| Catalog # | HPA060897 |
|---|
| Price | |
|---|
| Order / More Info | CXorf40B Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|