| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SULT1A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SULT1A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SULT1A2. This antibody reacts with human. The SULT1A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SULT1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL |
|---|
| Other Names | Aryl sulfotransferase 2, arylamine sulfotransferase, EC 2.8.2, EC 2.8.2.1, HAST4, MGC142287, MGC142289, Phenol sulfotransferase 2, phenolic-metabolizing (P) form of PST, phenol-preferring phenol sulfotransferase2, Phenol-sulfating phenol sulfotransferase 2, P-PST 2, ST1A2, STP2P-PST, sulfotransferase 1A2, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2, thermostable phenol sulfotransferase, TSPST2 |
|---|
| Gene, Accession # | SULT1A2, Gene ID: 6799, Accession: P50226, SwissProt: P50226 |
|---|
| Catalog # | NBP2-31904 |
|---|
| Price | |
|---|
| Order / More Info | SULT1A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|