| Edit |   |
|---|
| Antigenic Specificity | LRRC28 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC28 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC28. This antibody reacts with human. The LRRC28 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC28(leucine rich repeat containing 28) The peptide sequence was selected from the N terminal of LRRC28. Peptide sequence KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG. |
|---|
| Other Names | FLJ34269, FLJ45242, leucine rich repeat containing 28, leucine-rich repeat-containing protein 28, MGC24976 |
|---|
| Gene, Accession # | LRRC28, Gene ID: 123355, Accession: Q86X40, SwissProt: Q86X40 |
|---|
| Catalog # | NBP1-52848 |
|---|
| Price | |
|---|
| Order / More Info | LRRC28 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|