| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SWAP70 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunocytochemistry. ICC, WB reported in scientific literature (PMID: 27806292). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SWAP70 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SWAP70. This antibody reacts with human, mouse, rat. The SWAP70 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunocytochemistry. Specificity of human, mouse, rat SWAP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR |
|---|
| Other Names | KIAA0640SWAP-70FLJ39540, SWAP switching B-cell complex 70kDa subunit, switch-associated protein 70 |
|---|
| Gene, Accession # | SWAP70, Gene ID: 23075 |
|---|
| Catalog # | NBP1-82979 |
|---|
| Price | |
|---|
| Order / More Info | SWAP70 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27806292 |
|---|
| 产品资料 |
|
|