| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SWAP70 |
|---|
| Clone | 3H8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SWAP70 Antibody (3H8) from Novus Biologicals is a mouse monoclonal antibody to SWAP70. This antibody reacts with human, mouse, rat. The SWAP70 Antibody (3H8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SWAP70 (NP_055870, 378 a.a. 451 a.a) partial recombinant protein with GST tag. QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA |
|---|
| Other Names | KIAA0640SWAP-70FLJ39540, SWAP switching B-cell complex 70kDa subunit, switch-associated protein 70 |
|---|
| Gene, Accession # | SWAP70, Gene ID: 23075, Accession: NP_055870, SwissProt: NP_055870 |
|---|
| Catalog # | H00023075-M09-100ug |
|---|
| Price | |
|---|
| Order / More Info | SWAP70 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|