| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SWSAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SWSAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SWSAP1. This antibody reacts with human. The SWSAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SWSAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD |
|---|
| Other Names | ATPase SWSAP1, C19orf39, Chromosome 19 Open Reading Frame 39, SWIM-Type Containing 7 Associated Protein 1, SWIM-Type Zinc Finger 7 Associated Protein 1, SWIM-Type Zinc Finger 7-Associated Protein 1, SWS1AP1, SWS1-Associated Protein 1, Zinc Finger, Zinc Finger, SWIM-Type Containing 7 Associated Protein 1, ZSWIM7AP1, ZSWIM7-Associated Protein 1 |
|---|
| Gene, Accession # | SWSAP1, Gene ID: 126074, Accession: Q6NVH7, SwissProt: Q6NVH7 |
|---|
| Catalog # | NBP2-30909 |
|---|
| Price | |
|---|
| Order / More Info | SWSAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|