| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PA28 Activator alpha Subunit/PSME1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PA28 Activator alpha Subunit/PSME1 Antibody from Novus Biologicals is a mouse polyclonal antibody to PA28 Activator alpha Subunit/PSME1. This antibody reacts with human. The PA28 Activator alpha Subunit/PSME1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PSME1 (AAH00352, 1 a.a. - 249 a.a.) full-length human protein. MAMLRVQPEAQAKVDVFREDLCTKAENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY |
|---|
| Other Names | 11S regulator complex alpha subunit, 11S regulator complex subunit alpha, 29-kD MCP activator subunit, IFI5111MGC8628, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, interferon-gamma IEF SSP 5111, interferon-gamma-inducible protein 5111, PA28a, PA28alphaActivator of multicatalytic protease subunit 1, proteasome (prosome, macropain) activator subunit 1 (PA28 alpha), Proteasome activator 28 subunit alpha, proteasome activator complex subunit 1, proteasome activator subunit-1, REGalpha, REG-alpha |
|---|
| Gene, Accession # | PSME1, Gene ID: 5720, Accession: AAH00352, SwissProt: AAH00352 |
|---|
| Catalog # | H00005720-B01P |
|---|
| Price | |
|---|
| Order / More Info | PA28 Activator alpha Subunit/PSME1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|