| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PA28 Activator beta Subunit/PSME2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PA28 Activator beta Subunit/PSME2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PA28 Activator beta Subunit/PSME2. This antibody reacts with human. The PA28 Activator beta Subunit/PSME2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PA28 Activator beta Subunit/PSME2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK |
|---|
| Other Names | 11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Proteasome activator 28 subunit beta, proteasome activator 28-beta, proteasome activator complex subunit 2, proteasome activator hPA28 subunit beta, REGbeta, REG-beta |
|---|
| Gene, Accession # | PSME2, Gene ID: 5721 |
|---|
| Catalog # | NBP2-57628 |
|---|
| Price | |
|---|
| Order / More Info | PA28 Activator beta Subunit/PSME2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|