| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PA28 Activator beta Subunit/PSME2 |
|---|
| Clone | 1G4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PA28 Activator beta Subunit/PSME2 Antibody (1G4) from Novus Biologicals is a mouse monoclonal antibody to PA28 Activator beta Subunit/PSME2. This antibody reacts with human. The PA28 Activator beta Subunit/PSME2 Antibody (1G4) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PSME2 (NP_002809, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK |
|---|
| Other Names | 11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Proteasome activator 28 subunit beta, proteasome activator 28-beta, proteasome activator complex subunit 2, proteasome activator hPA28 subunit beta, REGbeta, REG-beta |
|---|
| Gene, Accession # | PSME2, Gene ID: 5721, Accession: NP_002809, SwissProt: NP_002809 |
|---|
| Catalog # | H00005721-M02 |
|---|
| Price | |
|---|
| Order / More Info | PA28 Activator beta Subunit/PSME2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|