| 产品详情 |
| Edit |   |
| Antigenic Specificity | PA28 Activator gamma Subunit/PSME3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PA28 Activator gamma Subunit/PSME3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PA28 Activator gamma Subunit/PSME3. This antibody reacts with human, mouse. The PA28 Activator gamma Subunit/PSME3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: 3 |
| Immunogen | Synthetic peptides corresponding to PSME3(proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)) The peptide sequence was selected from the N terminal of human PSME3. Peptide sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECE |
| Other Names | 11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, PA28g, PA28gamma, PA28-gamma, PA28GKi nuclear autoantigen, proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 subunit gamma, proteasome activator 28-gamma, proteasome activator complex subunit 3, REG-gamma |
| Gene, Accession # | PSME3, Gene ID: 10197, Accession: P61289-2, SwissProt: P61289-2 |
| Catalog # | NBP1-54587 |
| Price | |
| Order / More Info | PA28 Activator gamma Subunit/PSME3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24691443 |
| 产品资料 |
|
|