| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Histone H2AY/macroH2A.1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Histone H2AY/macroH2A.1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Histone H2AY/macroH2A.1. This antibody reacts with human. The Histone H2AY/macroH2A.1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Histone H2AY/macroH2A |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK |
|---|
| Other Names | core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1 |
|---|
| Gene, Accession # | H2AFY, Gene ID: 9555 |
|---|
| Catalog # | NBP2-56819 |
|---|
| Price | |
|---|
| Order / More Info | Histone H2AY/macroH2A.1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|