| 产品详情 |
| Edit |   |
| Antigenic Specificity | TSC22/TSC22D1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSC22/TSC22D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSC22/TSC22D1. This antibody reacts with human. The TSC22/TSC22D1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TSC22/TSC22D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP |
| Other Names | Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transforming growth factor beta-stimulated protein TSC-22, TSC22 domain family 1, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22DKFZp686O19206 |
| Gene, Accession # | TSC22D1, Gene ID: 8848 |
| Catalog # | NBP2-54941 |
| Price | |
| Order / More Info | TSC22/TSC22D1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|