| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSEN34 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSEN34 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSEN34. This antibody reacts with human. The TSEN34 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSEN34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQPDGKVVYTSLQW |
|---|
| Other Names | EC 3.1.27.9, hsSen34, leukocyte receptor cluster (LRC) member 5, Leukocyte receptor cluster member 5, PCH2C, SEN34LENG5SEN34L, tRNA splicing endonuclease 34 homolog (S. cerevisiae), tRNA splicing endonuclease 34 homolog (SEN34, S. cerevisiae), tRNA-intron endonuclease Sen34, tRNA-splicing endonuclease subunit Sen34 |
|---|
| Gene, Accession # | TSEN34, Gene ID: 79042 |
|---|
| Catalog # | NBP1-81315 |
|---|
| Price | |
|---|
| Order / More Info | TSEN34 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|