| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSEN54 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSEN54 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSEN54. This antibody reacts with human. The TSEN54 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSEN54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTHLPDGGVRLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKRLSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDV |
|---|
| Other Names | hsSen54, PCH2A, PCH4, sen54, SEN54 homolog, SEN54FLJ37147, SEN54L, tRNA splicing endonuclease 54 homolog (S. cerevisiae), tRNA splicing endonuclease 54 homolog (SEN54, S. cerevisiae), tRNA-intron endonuclease Sen54, tRNA-splicing endonuclease subunit Sen54 |
|---|
| Gene, Accession # | TSEN54, Gene ID: 283989, Accession: Q7Z6J9, SwissProt: Q7Z6J9 |
|---|
| Catalog # | NBP2-30377 |
|---|
| Price | |
|---|
| Order / More Info | TSEN54 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|