| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAJB13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAJB13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAJB13. This antibody reacts with human. The DNAJB13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNAJB13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE |
|---|
| Other Names | DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748 |
|---|
| Gene, Accession # | DNAJB13, Gene ID: 374407, Accession: P59910, SwissProt: P59910 |
|---|
| Catalog # | NBP2-30620 |
|---|
| Price | |
|---|
| Order / More Info | DNAJB13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|