| 产品详情 |
| Edit |   |
| Antigenic Specificity | DNAJB13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DNAJB13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAJB13. This antibody reacts with human. The DNAJB13 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE |
| Other Names | DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748 |
| Gene, Accession # | DNAJB13, Gene ID: 374407 |
| Catalog # | NBP2-68770 |
| Price | |
| Order / More Info | DNAJB13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|