| Edit |   |
|---|
| Antigenic Specificity | CFAP97 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CFAP97 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CFAP97. This antibody reacts with human. The CFAP97 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human KIAA1430The immunogen for this antibody is KIAA1430. Peptide sequence NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG. |
|---|
| Other Names | KIAA1430 |
|---|
| Gene, Accession # | KIAA1430, Gene ID: 57587, Accession: NP_065878, SwissProt: NP_065878 |
|---|
| Catalog # | NBP1-79676-20ul |
|---|
| Price | |
|---|
| Order / More Info | CFAP97 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|