| Edit |   |
| Antigenic Specificity | CFAP97 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CFAP97 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CFAP97. This antibody reacts with human. The CFAP97 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human KIAA1430The immunogen for this antibody is KIAA1430. Peptide sequence NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG. |
| Other Names | KIAA1430 |
| Gene, Accession # | KIAA1430, Gene ID: 57587, Accession: NP_065878, SwissProt: NP_065878 |
| Catalog # | NBP1-79676 |
| Price | |
| Order / More Info | CFAP97 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |