| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRD2. This antibody reacts with human. The BRD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, BRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP |
|---|
| Other Names | bromodomain containing 2, bromodomain-containing 2, bromodomain-containing protein 2, D6S113E, female sterile homeotic-related gene 1, FSRG1FSH, KIAA9001FLJ31942, NAT, O27.1.1, Really interesting new gene 3 protein, RING3DKFZp686N0336, RNF3 |
|---|
| Gene, Accession # | BRD2, Gene ID: 6046 |
|---|
| Catalog # | NBP1-84310 |
|---|
| Price | |
|---|
| Order / More Info | BRD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|