| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRD2 |
|---|
| Clone | 3D10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRD2 Antibody (3D10) from Novus Biologicals is a mouse monoclonal antibody to BRD2. This antibody reacts with human. The BRD2 Antibody (3D10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | BRD2 (NP_005095 167 a.a. - 256 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS |
|---|
| Other Names | bromodomain containing 2, bromodomain-containing 2, bromodomain-containing protein 2, D6S113E, female sterile homeotic-related gene 1, FSRG1FSH, KIAA9001FLJ31942, NAT, O27.1.1, Really interesting new gene 3 protein, RING3DKFZp686N0336, RNF3 |
|---|
| Gene, Accession # | BRD2, Gene ID: 6046, Accession: NP_005095, SwissProt: NP_005095 |
|---|
| Catalog # | H00006046-M01 |
|---|
| Price | |
|---|
| Order / More Info | BRD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24229708 |
|---|
| 产品资料 |
|
|