| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MFNG |
|---|
| Clone | 2B11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MFNG Antibody (2B11) from Novus Biologicals is a mouse monoclonal antibody to MFNG. This antibody reacts with human. The MFNG Antibody (2B11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MFNG (NP_002396, 214 a.a. - 291 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP |
|---|
| Other Names | beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
|---|
| Gene, Accession # | MFNG, Gene ID: 4242, Accession: NP_002396, SwissProt: NP_002396 |
|---|
| Catalog # | H00004242-M07 |
|---|
| Price | |
|---|
| Order / More Info | MFNG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|