| Edit |   |
|---|
| Antigenic Specificity | FANCD2OS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FANCD2OS Antibody from Novus Biologicals is a rabbit polyclonal antibody to FANCD2OS. This antibody reacts with human. The FANCD2OS Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C3ORF24 The peptide sequence was selected from the middle region of C3ORF24. Peptide sequence KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV. |
|---|
| Other Names | C3orf24, chromosome 3 open reading frame 24, fancd2 opposite strand, hypothetical protein LOC115795, RGD1565997 |
|---|
| Gene, Accession # | FANCD2OS, Gene ID: 115795 |
|---|
| Catalog # | NBP1-70471 |
|---|
| Price | |
|---|
| Order / More Info | FANCD2OS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|