| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC22A15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC22A15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC22A15. This antibody reacts with human. The SLC22A15 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC22A15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR |
|---|
| Other Names | DKFZp761G0313, Flipt 1, FLIPT1PRO34686, fly-like putative organic ion transporter 1, Fly-like putative transporter 1, solute carrier family 22 (organic cation transporter), member 15, solute carrier family 22 member 15, solute carrier family 22, member 15, trans-like protein |
|---|
| Gene, Accession # | SLC22A15, Gene ID: 55356 |
|---|
| Catalog # | NBP1-84662 |
|---|
| Price | |
|---|
| Order / More Info | SLC22A15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|