| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC22A17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC22A17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC22A17. This antibody reacts with human. The SLC22A17 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC22A17(solute carrier family 22, member 17) The peptide sequence was selected from the middle region of SLC22A17. Peptide sequence HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM. |
|---|
| Other Names | 24p3R, BOCTNGALR3, BOIThBOIT, Brain-type organic cation transporter, Lipocalin-2 receptor, Neutrophil gelatinase-associated lipocalin receptor, NgalR, NGALR2, NGALRNGAL receptor, potent brain type organic ion transporter, solute carrier family 22 (organic cation transporter), member 17, solute carrier family 22 member 17,24p3 receptor, solute carrier family 22, member 17 |
|---|
| Gene, Accession # | SLC22A17, Gene ID: 51310, Accession: Q8WUG5, SwissProt: Q8WUG5 |
|---|
| Catalog # | NBP1-59889 |
|---|
| Price | |
|---|
| Order / More Info | SLC22A17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|