| Edit |   |
| Antigenic Specificity | SLC22A24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC22A24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC22A24. This antibody reacts with human. The SLC22A24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC34821 The peptide sequence was selected from the middle region of MGC34821. Peptide sequence VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF. |
| Other Names | MGC34821, NET46, solute carrier family 22 member 24, solute carrier family 22, member 24 |
| Gene, Accession # | SLC22A24, Gene ID: 283238, Accession: C9JC66, SwissProt: C9JC66 |
| Catalog # | NBP1-56814 |
| Price | |
| Order / More Info | SLC22A24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |