| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Complement C4b |
|---|
| Clone | 2E3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Complement C4b Antibody (2E3) from Novus Biologicals is a mouse monoclonal antibody to Complement C4b. This antibody reacts with human. The Complement C4b Antibody (2E3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | C4B (NP_000583 1347 a.a. - 1446 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG |
|---|
| Other Names | basic C4, Basic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3, C4B1, C4B12, C4B2, C4B3, C4FMGC164979, CH, Chido form of C4, CO4C4B5, complement C4-B, complement C4B1a, complement component 4B, complement component 4B (Chido blood group), CPAMD3FLJ60561, EC 2.1.1.144, EC 2.7.11 |
|---|
| Gene, Accession # | C4B, Gene ID: 721, Accession: NP_000583, SwissProt: NP_000583 |
|---|
| Catalog # | H00000721-M01 |
|---|
| Price | |
|---|
| Order / More Info | Complement C4b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|