| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VMAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VMAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VMAT2. This antibody reacts with human. The VMAT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD |
|---|
| Other Names | MGC120477, monoamine neurotransmitter transporter, Monoamine transporter, solute carrier family 18 (vesicular monoamine), member 2, Solute carrier family 18 member 2, SVAT, SVMTMGC120478, synaptic vesicular amine transporter, VAT2MGC26538, vesicle monoamine transporter type 2, vesicle monoamine/H+ antiporter, Vesicular amine transporter 2, VMAT2 |
|---|
| Gene, Accession # | SLC18A2, Gene ID: 6571 |
|---|
| Catalog # | NBP2-68952 |
|---|
| Price | |
|---|
| Order / More Info | VMAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|