| Edit |   |
| Antigenic Specificity | PWP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PWP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PWP1. This antibody reacts with human. The PWP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human PWP1The immunogen for this antibody is PWP1. Peptide sequence FCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARN. |
| Other Names | IEF-SSP-9502, Keratinocyte protein IEF SSP 9502, nuclear phosphoprotein similar to S. cerevisiae PWP1, periodic tryptophan protein 1 homolog, PWP1 homolog (S. cerevisiae) |
| Gene, Accession # | PWP1, Gene ID: 11137, Accession: NP_008993, SwissProt: NP_008993 |
| Catalog # | NBP1-79378-20ul |
| Price | |
| Order / More Info | PWP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |