| Edit |   |
| Antigenic Specificity | PWP2H |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PWP2H Antibody from Novus Biologicals is a rabbit polyclonal antibody to PWP2H. This antibody reacts with human. The PWP2H Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM. |
| Other Names | periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17 |
| Gene, Accession # | PWP2, Gene ID: 5822, Accession: Q15269, SwissProt: Q15269 |
| Catalog # | NBP1-52844-20ul |
| Price | |
| Order / More Info | PWP2H Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |