| 产品详情 |
| Edit |   |
| Antigenic Specificity | NDUFA9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NDUFA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFA9. This antibody reacts with human. The NDUFA9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NDUFA9(NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa) The peptide sequence was selected from the N terminal of NDUFA9. Peptide sequence QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY. |
| Other Names | CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1 |
| Gene, Accession # | NDUFA9, Gene ID: 4704, Accession: Q16795, SwissProt: Q16795 |
| Catalog # | NBP1-54761-20ul |
| Price | |
| Order / More Info | NDUFA9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|