| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA8 |
|---|
| Clone | 2E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA8 Antibody (2E10) from Novus Biologicals is a mouse monoclonal antibody to NDUFA8. This antibody reacts with human. The NDUFA8 Antibody (2E10) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | NDUFA8 (NP_055037.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR |
|---|
| Other Names | CI-19KD, CI-PGIV, complex I PGIV subunit, Complex I-19kD, Complex I-PGIV, MGC793, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8, NADH:ubiquinone oxidoreductase PGIV subunit, NADH-ubiquinone oxidoreductase 19 kDa subunit, PGIV |
|---|
| Gene, Accession # | NDUFA8, Gene ID: 4702, Accession: NP_055037, SwissProt: NP_055037 |
|---|
| Catalog # | H00004702-M05 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|