| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFA9 |
|---|
| Clone | 3D7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFA9 Antibody (3D7) from Novus Biologicals is a mouse monoclonal antibody to NDUFA9. This antibody reacts with human, mouse, rat. The NDUFA9 Antibody (3D7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | NDUFA9 (NP_004993 303 a.a. - 377 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI |
|---|
| Other Names | CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1 |
|---|
| Gene, Accession # | NDUFA9, Gene ID: 4704, Accession: NP_004993, SwissProt: NP_004993 |
|---|
| Catalog # | H00004704-M01 |
|---|
| Price | |
|---|
| Order / More Info | NDUFA9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|