| 产品详情 |
| Edit |   |
| Antigenic Specificity | GGPS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GGPS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GGPS1. This antibody reacts with human. The GGPS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to GGPS1(geranylgeranyl diphosphate synthase 1) The peptide sequence was selected from the middle region of GGPS1 (NP_001032354). Peptide sequence LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ. |
| Other Names | 6E)-farnesyl diphosphate synthase, Dimethylallyltranstransferase, EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29, Farnesyl diphosphate synthase, Farnesyltranstransferase, Geranylgeranyl diphosphate synthase, geranylgeranyl diphosphate synthase 1, geranylgeranyl pyrophosphate synthase, geranyltranstransferase, GGPP synthase, GGPPS, GGPPS1farnesyltranstransferase, GGPPSase |
| Gene, Accession # | GGPS1, Gene ID: 9453, Accession: O95749, SwissProt: O95749 |
| Catalog # | NBP1-53050 |
| Price | |
| Order / More Info | GGPS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|