| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GGT1 |
|---|
| Clone | 1F9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 29935878). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GGT1 Antibody (1F9) from Novus Biologicals is a mouse monoclonal antibody to GGT1. This antibody reacts with human, mouse. The GGT1 Antibody (1F9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | GGT1 (NP_005256, 381 a.a. - 470 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG |
|---|
| Other Names | CD224, CD224 antigen, D22S672, D22S732, EC 2.3.2.2, gamma-glutamyl transpeptidase, gamma-glutamyltransferase 1MGC96904, gamma-glutamyltranspeptidase 1, GGT 1, GGTMGC96963, glutamyl transpeptidase, GTG, MGC96892 |
|---|
| Gene, Accession # | GGT1, Gene ID: 2678, Accession: NP_005256, SwissProt: NP_005256 |
|---|
| Catalog # | H00002678-M01 |
|---|
| Price | |
|---|
| Order / More Info | GGT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20622017, 21712391, 23308193, 25755490, 28476099, 29935878 |
|---|
| 产品资料 |
|
|