| 产品详情 |
| Edit |   |
| Antigenic Specificity | GHITM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GHITM Antibody from Novus Biologicals is a rabbit polyclonal antibody to GHITM. This antibody reacts with human. The GHITM Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GHITM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK |
| Other Names | Dermal papilla-derived protein 2, DERP2MICS1, DKFZp566C0746, FLJ26584, growth hormone inducible transmembrane protein, growth hormone-inducible transmembrane protein, HSPC282, Mitochondrial morphology and cristae structure 1, PTD010, TMBIM5My021, transmembrane BAX inhibitor motif containing 5, Transmembrane BAX inhibitor motif-containing protein 5 |
| Gene, Accession # | GHITM, Gene ID: 27069 |
| Catalog # | NBP1-84269 |
| Price | |
| Order / More Info | GHITM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|