| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ghrelin/Obestatin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ghrelin/Obestatin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ghrelin/Obestatin. This antibody reacts with human. The Ghrelin/Obestatin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Ghrelin/Obestatin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS |
| Other Names | appetite-regulating hormone, ghrelin, ghrelin/obestatin preprohormone, ghrelin/obestatin prepropeptide, Growth hormone secretagogue, Growth hormone-releasing peptide, Motilin-related peptide, MTLRPgrowth hormone secretagogue receptor ligand, obestatin, Protein M46 |
| Gene, Accession # | GHRL, Gene ID: 51738 |
| Catalog # | NBP1-89773 |
| Price | |
| Order / More Info | Ghrelin/Obestatin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|