| Edit |   |
| Antigenic Specificity | AMDHD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AMDHD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMDHD1. This antibody reacts with human. The AMDHD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to AMDHD1(amidohydrolase domain containing 1) The peptide sequence was selected from the N terminal of AMDHD1. Peptide sequence AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV. |
| Other Names | amidohydrolase domain containing 1, Amidohydrolase domain-containing protein 1, EC 3.5.2.7, MGC35366, probable imidazolonepropionase |
| Gene, Accession # | AMDHD1, Gene ID: 144193, Accession: Q96NU7, SwissProt: Q96NU7 |
| Catalog # | NBP1-56721-20ul |
| Price | |
| Order / More Info | AMDHD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |