| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kirrel3/NEPH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kirrel3/NEPH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kirrel3/NEPH2. This antibody reacts with human. The Kirrel3/NEPH2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kirrel3/NEPH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR |
|---|
| Other Names | KIAA1867MGC126824, kin of IRRE like 3 (Drosophila), Kin of irregular chiasm-like protein 3, kin of IRRE-like protein 3, KIRREPRO4502, MRD4, NEPH2MGC126850, nephrin-like 2, Nephrin-like protein 2 |
|---|
| Gene, Accession # | KIRREL3, Gene ID: 84623, Accession: Q8IZU9, SwissProt: Q8IZU9 |
|---|
| Catalog # | NBP2-38788 |
|---|
| Price | |
|---|
| Order / More Info | Kirrel3/NEPH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|