| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dihydrolipoamide Dehydrogenase/DLD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dihydrolipoamide Dehydrogenase/DLD Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dihydrolipoamide Dehydrogenase/DLD. This antibody reacts with human. The Dihydrolipoamide Dehydrogenase/DLD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Dihydrolipoamide Dehydrogenase/DLD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGK SEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK |
|---|
| Other Names | 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex), branched chain keto acid dehydrogenase complex, dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenasemitochondrial, DLDH, E3, E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex, EC 1.8.1, EC 1.8.1.4, GCSL, Glycine cleavage system L protein, glycine cleavage system protein L, lipoamide dehydrogenase, lipoamide reductase, lipoyl dehydrogenase |
|---|
| Gene, Accession # | DLD, Gene ID: 1738 |
|---|
| Catalog # | NBP2-13926 |
|---|
| Price | |
|---|
| Order / More Info | Dihydrolipoamide Dehydrogenase/DLD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|