| 产品详情 |
| Edit |   |
| Antigenic Specificity | SART1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SART1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SART1. This antibody reacts with human, mouse, rat. The SART1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SART1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER |
| Other Names | Allergen Hom s 1, Ara1, HAF, HOMS1, hSART-1, hSnu66, hypoxia-associated factor, IgE autoantigen, MGC2038, SART-1, SART1(259) protein, SART1(800) protein, SART1259, small nuclear ribonucleoprotein 110kDa (U4/U6.U5), SNRNP110, Snu66, SNU66 homolog, squamous cell carcinoma antigen recognised by T cells, squamous cell carcinoma antigen recognized by T cells, Squamous cell carcinoma antigen recognized by T cells 1, U4/U6.U5 tri-snRNP-associated 110 kDa protein, U4/U6.U5 tri-snRNP-associated protein 1 |
| Gene, Accession # | SART1, Gene ID: 9092 |
| Catalog # | NBP1-89024 |
| Price | |
| Order / More Info | SART1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|