| Edit |   |
| Antigenic Specificity | TIGD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TIGD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIGD1. This antibody reacts with human. The TIGD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TIGD1(tigger transposable element derived 1) The peptide sequence was selected from the middle region of TIGD1. Peptide sequence SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE. |
| Other Names | EEYORE, tigger transposable element derived 1, tigger transposable element-derived protein 1 |
| Gene, Accession # | TIGD1, Gene ID: 200765, Accession: Q96MW7, SwissProt: Q96MW7 |
| Catalog # | NBP1-55189-20ul |
| Price | |
| Order / More Info | TIGD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |