| Edit |   |
| Antigenic Specificity | TIGD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TIGD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIGD4. This antibody reacts with mouse. The TIGD4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Tigd4. Immunizing peptide sequence LRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPS. |
| Other Names | MGC43837, tigger transposable element derived 4, tigger transposable element-derived protein 4 |
| Gene, Accession # | TIGD4, Gene ID: 201798, Accession: Q8BUZ3 |
| Catalog # | NBP1-74161 |
| Price | |
| Order / More Info | TIGD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |