| Edit |   |
|---|
| Antigenic Specificity | LCN12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LCN12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LCN12. This antibody reacts with human. The LCN12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG. |
|---|
| Other Names | epididymal-specific lipocalin-12, lipocalcin 12, lipocalin 12, MGC34753, MGC48935 |
|---|
| Gene, Accession # | LCN12, Gene ID: 286256, Accession: Q8IW14, SwissProt: Q8IW14 |
|---|
| Catalog # | NBP1-58052-20ul |
|---|
| Price | |
|---|
| Order / More Info | LCN12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|