| Edit |   |
| Antigenic Specificity | LCN12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LCN12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LCN12. This antibody reacts with human. The LCN12 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG. |
| Other Names | epididymal-specific lipocalin-12, lipocalcin 12, lipocalin 12, MGC34753, MGC48935 |
| Gene, Accession # | LCN12, Gene ID: 286256, Accession: Q8IW14, SwissProt: Q8IW14 |
| Catalog # | NBP1-58052 |
| Price | |
| Order / More Info | LCN12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |