| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHLRC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHLRC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHLRC2. This antibody reacts with human. The NHLRC2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NHLRC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHLIRKIDLEAEKVSTVAGIGIQGTDKEGGAKGEQQPIS |
|---|
| Other Names | DKFZp779F115,1200003G01Rik, FLJ20147, FLJ25621, FLJ33312, MGC45492, NHL repeat containing 2, NHL repeat-containing protein 2, novel NHL repeat domain containing protein |
|---|
| Gene, Accession # | NHLRC2, Gene ID: 374354 |
|---|
| Catalog # | NBP2-55820 |
|---|
| Price | |
|---|
| Order / More Info | NHLRC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|